PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013606292.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 360aa    MW: 40729 Da    PI: 6.5105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013606292.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
   XP_013606292.1 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.12.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
   XP_013606292.1  67 RGEFSSEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SuperFamilySSF466899.35E-2911108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-171461IPR001005SANT/Myb domain
CDDcd001674.73E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.75366116IPR017930Myb domain
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1367112IPR001005SANT/Myb domain
CDDcd001673.17E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEQG  120
THPLTHKPLA SNTNPTVPEN LHSLDASSNS DKQYSRSSSM PSMSCTPSSG FNTVFENTSK  180
DGTPVREDDS LSRKKRFKKS SSTSRLLNKV AAKATSMKEA LSASMEGSLN ANISFSNGYS  240
EQILNEDDSS NASLINTLAE FDPFLQTTFY PENEMNTTSD LGIDQDYFSH FLENFGNHNE  300
EHYMNHNYGH GLLMSYVSQE VSSTSVDDQD NTNEGWSNYL LDHADFIHDM DSDSLGKHLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2627660.0KM262766.1 Brassica oleracea var. italica cultivar Fuqing 1 MYB28-2 transcription factor (myb28-2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013606292.10.0PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A0D3E1Q80.0A0A0D3E1Q8_BRAOL; Uncharacterized protein
STRINGBra035929.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.21e-169myb domain protein 28